Компонент 1q системи комплементу

Компонент 1 системи комплементу
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1P32, 3RPX

Ідентифікатори
Символи C1QBP, GHABP1, SF2p32, gC1Q-R, gC1qR, p32, complement component 1, q subcomponent binding protein, complement C1q binding protein, COXPD33, SF2AP32
Зовнішні ІД OMIM: 601269 MGI: 1194505 HomoloGene: 31023 GeneCards: C1QBP
Онтологія гена
Молекулярна функція

GO:0001106 transcription corepressor activity
transcription factor binding
GO:0001948, GO:0016582 protein binding
hyaluronic acid binding
kininogen binding
mitochondrial ribosome binding
mRNA binding
protein kinase C binding
complement component C1q complex binding
adrenergic receptor binding
translation activator activity

Клітинна компонента

гіалоплазма
extracellular region
cell surface
мітохондріальний матрикс
ядерце
цитоплазма
мембрана
мітохондрія
клітинне ядро
міжклітинний простір
клітинна мембрана
presynaptic active zone
presynapse
glutamatergic synapse
GABA-ergic synapse

Біологічний процес

blood coagulation, intrinsic pathway
positive regulation of mitochondrial translation
negative regulation of interferon-gamma production
positive regulation of protein kinase B signaling
negative regulation of MDA-5 signaling pathway
GO:0009373 regulation of transcription, DNA-templated
адаптивна імунна відповідь
ribosome biogenesis
negative regulation of defense response to virus
процес імунної системи
mRNA processing
GO:1901227 negative regulation of transcription by RNA polymerase II
transcription, DNA-templated
positive regulation of trophoblast cell migration
positive regulation of substrate adhesion-dependent cell spreading
mature ribosome assembly
negative regulation of mRNA splicing, via spliceosome
GO:0046730, GO:0046737, GO:0046738, GO:0046736 імунна відповідь
Сплайсинг РНК
positive regulation of neutrophil chemotaxis
complement activation, classical pathway
positive regulation of apoptotic process
phosphatidylinositol 3-kinase signaling
вроджений імунітет
GO:0022415 viral process
positive regulation of dendritic cell chemotaxis
regulation of complement activation
negative regulation of RIG-I signaling pathway
positive regulation of cell adhesion
negative regulation of interleukin-12 production
GO:0097285 апоптоз

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
708
12261
Ensembl
ENSG00000108561
ENSMUSG00000018446
UniProt
Q07021
O35658
Q8R5L1
RefSeq (мРНК)
NM_001212
NM_007573
RefSeq (білок)
NP_001203
NP_031599
Локус (UCSC) Хр. 17: 5.43 – 5.45 Mb Хр. 11: 70.87 – 70.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Компонент 1q системи комплементу (англ. Complement C1q binding protein) – білок, який кодується геном C1QBP, розташованим у людей на короткому плечі 17-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 282 амінокислот, а молекулярна маса — 31 362[4].

Послідовність амінокислот
1020304050
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRA
GSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHK
TLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPS
QGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
SDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDN
TFADELVELSTALEHQEYITFLEDLKSFVKSQ

Задіяний у таких біологічних процесах як апоптоз, адаптивний та вроджений імунітет, взаємодія хазяїн-вірус, процесінг мРНК, сплайсінг мРНК, транскрипція, регуляція транскрипції, шлях активації комплементу, біогенез рибосом.

Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані мітохондрії.

Також секретований назовні.

Література

  • Ghebrehiwet B., Lim B.L., Peerschke E.I., Willis A.C., Reid K.B. (1994). Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular 'heads' of C1q. J. Exp. Med. 179: 1809—1821. PMID 8195709 DOI:10.1084/jem.179.6.1809
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Krainer A.R., Mayeda A., Kozak D., Binns G. (1991). Functional expression of cloned human splicing factor SF2: homology to RNA-binding proteins, U1 70K, and Drosophila splicing regulators. Cell. 66: 383—394. PMID 1830244 DOI:10.1016/0092-8674(91)90627-B
  • Herwald H., Dedio J., Kellner R., Loos M., Muller-Esterl W. (1996). Isolation and characterization of the kininogen-binding protein p33 from endothelial cells. Identity with the gC1q receptor. J. Biol. Chem. 271: 13040—13047. PMID 8662673 DOI:10.1074/jbc.271.22.13040
  • Deb T.B., Datta K. (1996). Molecular cloning of human fibroblast hyaluronic acid-binding protein confirms its identity with P-32, a protein co-purified with splicing factor SF2. Hyaluronic acid-binding protein as P-32 protein, co-purified with splicing factor SF2. J. Biol. Chem. 271: 2206—2212. PMID 8567680 DOI:10.1074/jbc.271.4.2206
  • Joseph K., Ghebrehiwet B., Peerschke E.I., Reid K.B., Kaplan A.P. (1996). Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular 'heads' of C1q (gC1q-R). Proc. Natl. Acad. Sci. U.S.A. 93: 8552—8557. PMID 8710908 DOI:10.1073/pnas.93.16.8552

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1243 (англ.) . Архів оригіналу за 25 Березня 2016. Процитовано 30 січня 2017.
  4. UniProt, Q07021 (англ.) . Архів оригіналу за 26 Лютого 2017. Процитовано 30 січня 2017.

Див. також

  • Хромосома 17
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»