CEBPB

CEBPB
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1GTW, 1GU4, 1GU5, 1H88, 1H89, 1H8A, 1HJB, 1IO4, 2E42, 2E43

Ідентифікатори
Символи CEBPB, C/EBP-beta, IL6DBP, NF-IL6, TCF5, CCAAT/enhancer binding protein beta, CCAAT enhancer binding protein beta
Зовнішні ІД OMIM: 189965 MGI: 88373 HomoloGene: 3807 GeneCards: CEBPB
Онтологія гена
Молекулярна функція

DNA binding
sequence-specific DNA binding
RNA polymerase II transcription regulatory region sequence-specific DNA binding
protein homodimerization activity
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
transcription factor binding
histone deacetylase binding
chromatin binding
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
kinase binding
GO:0001948, GO:0016582 protein binding
histone acetyltransferase binding
ubiquitin-like protein ligase binding
protein heterodimerization activity
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
RNA polymerase II core promoter sequence-specific DNA binding
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
glucocorticoid receptor binding

Клітинна компонента

цитоплазма
nuclear matrix
CHOP-C/EBP complex
нуклеоплазма
клітинне ядро
condensed chromosome, centromeric region
RNA polymerase II transcription regulator complex

Біологічний процес

GO:1904089 negative regulation of neuron apoptotic process
mammary gland epithelial cell proliferation
диференціація клітин
GO:0009373 regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
GO:1904579 cellular response to organic cyclic compound
embryonic placenta development
пам'ять
positive regulation of interleukin-4 production
response to endoplasmic reticulum stress
mammary gland epithelial cell differentiation
transcription, DNA-templated
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
negative regulation of T cell proliferation
liver regeneration
positive regulation of osteoblast differentiation
hepatocyte proliferation
response to lipopolysaccharide
regulation of osteoclast differentiation
defense response to bacterium
acute-phase response
GO:0046730, GO:0046737, GO:0046738, GO:0046736 імунна відповідь
neuron differentiation
cellular response to interleukin-1
brown fat cell differentiation
cellular response to amino acid stimulus
ovarian follicle development
liver development
inflammatory response
GO:0045996 negative regulation of transcription, DNA-templated
positive regulation of fat cell differentiation
cellular response to lipopolysaccharide
fat cell differentiation
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
transcription by RNA polymerase II
granuloma formation
T-helper 1 cell activation
GO:1901227 negative regulation of transcription by RNA polymerase II
regulation of odontoblast differentiation
positive regulation of biomineral tissue development
positive regulation of sodium-dependent phosphate transport
positive regulation of inflammatory response
positive regulation of cold-induced thermogenesis
regulation of dendritic cell differentiation

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
1051
12608
Ensembl
ENSG00000172216
ENSMUSG00000056501
UniProt
P17676
P28033
RefSeq (мРНК)
NM_005194
NM_001285878
NM_001285879
NM_001287738
NM_001287739
NM_009883
RefSeq (білок)
NP_001272807
NP_001272808
NP_005185
NP_001274667
NP_001274668
NP_034013
Локус (UCSC) Хр. 20: 50.19 – 50.19 Mb Хр. 2: 167.53 – 167.53 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEBPB (англ. CCAAT/enhancer binding protein beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 345 амінокислот, а молекулярна маса — 36 106[4].

Послідовність амінокислот
1020304050
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPP
AARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAA
PPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKG
ALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMA
AGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYA
GAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kinoshita S., Akira S., Kishimoto T. (1992). A member of the C/EBP family, NF-IL6 beta, forms a heterodimer and transcriptionally synergizes with NF-IL6. Proc. Natl. Acad. Sci. U.S.A. 89: 1473—1476. PMID 1741402 DOI:10.1073/pnas.89.4.1473
  • Chinery R., Brockman J.A., Dransfield D.T., Coffey R.J. (1997). Antioxidant-induced nuclear translocation of CCAAT/enhancer-binding protein beta. A critical role for protein kinase A-mediated phosphorylation of Ser299. J. Biol. Chem. 272: 30356—30361. PMID 9374525 DOI:10.1074/jbc.272.48.30356
  • Podust L.M., Krezel A.M., Kim Y. (2001). Crystal structure of the CCAAT box/enhancer-binding protein beta activating transcription factor-4 basic leucine zipper heterodimer in the absence of DNA. J. Biol. Chem. 276: 505—513. PMID 11018027 DOI:10.1074/jbc.M005594200
  • Buck M., Poli V., Hunter T., Chojkier M. (2001). C/EBPbeta phosphorylation by RSK creates a functional XEXD caspase inhibitory box critical for cell survival. Mol. Cell. 8: 807—816. PMID 11684016 DOI:10.1016/S1097-2765(01)00374-4
  • Zhu Y., Saunders M.A., Yeh H., Deng W.G., Wu K.K. (2002). Dynamic regulation of cyclooxygenase-2 promoter activity by isoforms of CCAAT/enhancer-binding proteins. J. Biol. Chem. 277: 6923—6928. PMID 11741938 DOI:10.1074/jbc.M108075200

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1834 (англ.) . Процитовано 12 вересня 2017.
  4. UniProt, P17676 (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 20
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

Фактори транскрипції та внутрішньоклітинні рецептори
(1) Основні домени
(1.1) Лейцинова застібка (bZIP)
(1.2) Спіраль-петля-спіраль (bHLH)
(1.3) Спіраль-петля-спіраль
/ Лейцинова застібка
(bHLH-ZIP)
(1.4) NF-1
(1.5) RF-X
(1.6) Спіраль-інтервал-спіраль (bHSH)
(2) Цинк-координовані домени ДНК
(2.1)Ядерні рецептори з цинковими пальцями (Cys4)
підродина 1
підродина 2
підродина 3
підродина 4
підродина 5
підродина 6
підродина 0
(2.2) Інші цинкові пальці Cys4
(2.3) Cys2His2 з доменом цинкових пальців
(2.4) Cys6 цистеїн-цинковий кластер
(2.5) Цинкові пальці іншого складу
(2.6) WRKY
  • WRKY
(3) Домени спіраль-поворот-спіраль
(3.1) Гомеобокс
(3.2) Парний бокс
(3.3) Вилкова головка / Крилата спіраль
(3.4) Фактори теплового шоку
(3.5) Триптофановий кластер
(3.6) Домен транскрипційний енхансер
(4) Бета-складчасті фактори з незначним жолобковим контактом
(4.1) RHR
(4.2) STAT
(4.3) p53
(4.4) MADS
(4.6) TATA
(4.7) Високомобільна група
(4.9) Grainyhead
(4.10) Домен холодового шоку
(4.11) Runt
(0) Інші фактори транскрипції
(0.2) HMGI(Y)
(0.3) Pocket домен
(0.5) AP2/EREBP-подібні
  • AP2
  • EREBP
  • B3
(0.6) Інші