CIB1

CIB1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1DGU, 1DGV, 1XO5, 1Y1A, 2L4H, 2L4I, 2LM5

Ідентифікатори
Символи CIB1, CIB, CIBP, KIP1, PRKDCIP, SIP2-28, calcium and integrin binding 1
Зовнішні ІД OMIM: 602293 MGI: 1344418 HomoloGene: 4654 GeneCards: CIB1
Онтологія гена
Молекулярна функція

• protein serine/threonine kinase inhibitor activity
• calcium ion binding
• protein-membrane adaptor activity
• transmembrane transporter binding
• зв'язування з іоном металу
• protein C-terminus binding
• GO:0001948, GO:0016582 protein binding
• calcium-dependent protein kinase inhibitor activity
• protein kinase binding

Клітинна компонента

• цитоплазма
• везикула
• комплекс Ґольджі
• cell projection
• центросома
• мембрана
• growth cone
• клітинна мембрана
• нуклеоплазма
• центр організації мікротрубочок
• ruffle membrane
• аксон
• filopodium tip
• дендрит (нейробіологія)
• neuronal cell body
• apical plasma membrane
• ендоплазматичний ретикулум
• perinuclear region of cytoplasm
• neuron projection
• Сарколема
• екзосома
• цитоскелет
• клітинне ядро
• cell periphery
• lamellipodium

Біологічний процес

• GO:0033128 negative regulation of protein phosphorylation
• positive regulation of protein targeting to membrane
• thrombopoietin-mediated signaling pathway
• negative regulation of protein kinase B signaling
• диференціація клітин
• cellular response to nerve growth factor stimulus
• positive regulation of protein phosphorylation
• negative regulation of neuron projection development
• regulation of cell division
• positive regulation of cell migration involved in sprouting angiogenesis
• extrinsic apoptotic signaling pathway
• positive regulation of cell-matrix adhesion
• positive regulation of cell migration
• cellular response to growth factor stimulus
• cellular response to tumor necrosis factor
• Тромбоцитопоез
• negative regulation of apoptotic process
• negative regulation of megakaryocyte differentiation
• positive regulation of protein serine/threonine kinase activity
• positive regulation of calcineurin-NFAT signaling cascade
• поділ клітини
• cellular response to DNA damage stimulus
• negative regulation of microtubule depolymerization
• positive regulation of substrate adhesion-dependent cell spreading
• positive regulation of cell growth
• response to ischemia
• адгезія клітин
• regulation of cell population proliferation
• positive regulation of NF-kappaB transcription factor activity
• double-strand break repair
• Ангіогенез
• Сперматогенез
• positive regulation of cell population proliferation
• spermatid development
• positive regulation of ERK1 and ERK2 cascade
• cytoplasmic microtubule organization
• endomitotic cell cycle
• клітинний цикл
• positive regulation of cell adhesion mediated by integrin
• positive regulation of male germ cell proliferation
• negative regulation of cell population proliferation
• GO:0097285 апоптоз
• GO:0048554 positive regulation of catalytic activity
• negative regulation of protein kinase activity
• negative regulation of protein serine/threonine kinase activity
• positive regulation of protein localization to plasma membrane

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
10519
23991
Ensembl
ENSG00000185043
ENSMUSG00000030538
UniProt
Q99828
Q9Z0F4
RefSeq (мРНК)
NM_001277764
NM_006384
NM_001291275
NM_001291276
NM_011870
RefSeq (білок)
NP_001264693
NP_006375
NP_001278204
NP_001278205
NP_036000
Локус (UCSC) Хр. 15: 90.23 – 90.23 Mb Хр. 7: 79.88 – 79.88 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CIB1 (англ. Calcium and integrin binding 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 191 амінокислот, а молекулярна маса — 21 703[4].

Послідовність амінокислот
1020304050
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLR
AQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSD
TATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMK
QLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, клітинна адгезія, клітинний цикл, поділ клітини, ангіогенез, диференціація клітин, сперматогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном кальцію, іоном магнію. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, клітинних відростках, апараті гольджі.

Література

  • Naik U.P., Patel P.M., Parise L.V. (1997). Identification of a novel calcium-binding protein that interacts with the integrin alphaIIb cytoplasmic domain. J. Biol. Chem. 272: 4651—4654. PMID 9030514 DOI:10.1074/jbc.272.8.4651
  • Wu X., Lieber M.R. (1997). Interaction between DNA-dependent protein kinase and a novel protein, KIP. Mutat. Res. 385: 13—20. PMID 9372844 DOI:10.1016/S0921-8777(97)00035-9
  • Hattori A., Seki N., Hayashi A., Kozuma S., Saito T. (2000). Genomic structure of mouse and human genes for DNA-PKcs interacting protein (KIP). DNA Seq. 10: 415—418. PMID 10826701 DOI:10.3109/10425170009015612
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Stabler S.M., Ostrowski L.L., Janicki S.M., Monteiro M.J. (1999). A myristoylated calcium-binding protein that preferentially interacts with the Alzheimer's disease presenilin 2 protein. J. Cell Biol. 145: 1277—1292. PMID 10366599 DOI:10.1083/jcb.145.6.1277
  • Fang X., Chen C., Wang Q., Gu J., Chi C. (2001). The interaction of the calcium- and integrin-binding protein (CIBP) with the coagulation factor VIII. Thromb. Res. 102: 177—185. PMID 11323029 DOI:10.1016/S0049-3848(01)00229-8

Примітки

  1. ↑ Human PubMed Reference:.
  2. ↑ Mouse PubMed Reference:.
  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:16920 (англ.) . Процитовано 11 вересня 2017.
  4. ↑ UniProt, Q99828 (англ.) . Архів оригіналу за 26 серпня 2017. Процитовано 11 вересня 2017.

Див. також

  • Хромосома 15
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.