GATA3

GATA3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

4HC7, 4HC9, 4HCA

Ідентифікатори
Символи GATA3, HDR, HDRS, GATA binding protein 3
Зовнішні ІД OMIM: 131320 MGI: 95663 HomoloGene: 1550 GeneCards: GATA3
Пов'язані генетичні захворювання
ревматоїдний артрит, Гострий лімфобластний лейкоз, лімфогранульоматоз, hypoparathyroidism-deafness-renal disease syndrome[1]
Онтологія гена
Молекулярна функція

RNA polymerase II transcription regulatory region sequence-specific DNA binding
HMG box domain binding
chromatin binding
зв'язування з іоном металу
DNA binding
GO:0001158 cis-regulatory region sequence-specific DNA binding
sequence-specific DNA binding
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
interleukin-2 receptor binding
core promoter sequence-specific DNA binding
GO:0000975 transcription cis-regulatory region binding
protein dimerization activity
E-box binding
GO:0001948, GO:0016582 protein binding
zinc ion binding
transcription factor binding
GO:0001105 transcription coactivator activity
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001104 transcription coregulator activity

Клітинна компонента

клітинне ядро
transcription regulator complex
нуклеоплазма

Біологічний процес

negative regulation of cell population proliferation
regulation of establishment of cell polarity
ureteric bud formation
negative regulation of cell cycle
thymic T cell selection
response to ethanol
positive regulation of T cell differentiation
erythrocyte differentiation
inner ear morphogenesis
cell maturation
regulation of histone H3-K27 methylation
cardiac right ventricle morphogenesis
phosphatidylinositol 3-kinase signaling
norepinephrine biosynthetic process
ear development
homeostasis of number of cells
sympathetic nervous system development
T-helper 2 cell differentiation
regulation of cellular response to X-ray
Детермінація
post-embryonic development
cellular response to BMP stimulus
mesonephros development
neuron differentiation
regulation of neuron apoptotic process
GO:0072468 сигнальна трансдукція
cellular response to cytokine stimulus
cellular response to interleukin-4
T cell receptor signaling pathway
neuron migration
positive regulation of interleukin-5 production
regulation of CD4-positive, alpha-beta T cell differentiation
parathyroid gland development
negative regulation of DNA demethylation
positive regulation of interleukin-4 production
negative regulation of mammary gland epithelial cell proliferation
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
thymus development
нейробіологія розвитку
otic vesicle development
GO:0009373 regulation of transcription, DNA-templated
positive regulation of T-helper 2 cell cytokine production
regulation of nephron tubule epithelial cell differentiation
positive regulation of thyroid hormone generation
lymphocyte migration
negative regulation of interleukin-2 production
regulation of neuron projection development
uterus development
axon guidance
mesenchymal to epithelial transition
negative regulation of cell proliferation involved in mesonephros development
aortic valve morphogenesis
cellular response to tumor necrosis factor
negative regulation of fat cell differentiation
anatomical structure morphogenesis
cellular response to interferon-alpha
GO:0045996 negative regulation of transcription, DNA-templated
T cell differentiation
response to virus
negative regulation of endothelial cell apoptotic process
вроджений імунітет
canonical Wnt signaling pathway involved in metanephric kidney development
positive regulation of transcription regulatory region DNA binding
positive regulation of endothelial cell migration
positive regulation of interleukin-13 production
in utero embryonic development
negative regulation of interferon-gamma production
humoral immune response
developmental growth
розвиток нирки
positive regulation of ureteric bud formation
GO:1901313 positive regulation of gene expression
mast cell differentiation
positive regulation of histone H3-K9 acetylation
positive regulation of cell differentiation
GO:1901227 negative regulation of transcription by RNA polymerase II
male gonad development
nephric duct morphogenesis
ventricular septum development
GO:0032737 positive regulation of cytokine production
lens development in camera-type eye
negative regulation of fibroblast growth factor receptor signaling pathway involved in ureteric bud formation
transcription, DNA-templated
negative regulation of gene expression
parathyroid hormone secretion
nephric duct formation
процес імунної системи
negative regulation of inflammatory response
pharyngeal system development
embryonic organ development
response to estrogen
зсідання крові
negative regulation of glial cell-derived neurotrophic factor receptor signaling pathway involved in ureteric bud formation
positive regulation of signal transduction
ureter maturation
positive regulation of histone H3-K14 acetylation
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
response to gamma radiation
GO:0000767 cell morphogenesis
embryonic hemopoiesis
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
negative regulation of cell motility
pro-T cell differentiation
TOR signaling
type IV hypersensitivity
defense response
regulation of histone H3-K4 methylation
renal system development
positive regulation of protein kinase B signaling
cell activation
ремоделювання хроматину
T cell differentiation in thymus
cochlea development
transcription by RNA polymerase II
protein deubiquitination
anatomical structure formation involved in morphogenesis
regulation of hematopoietic stem cell differentiation
cytokine-mediated signaling pathway
heart development
animal organ morphogenesis
гістогенез
розвиток клітин
digestive tract development
immune system development
regulation of epithelial cell differentiation
ureter morphogenesis

Джерела:Amigo / QuickGO
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
2625
14462
Ensembl
ENSG00000107485
ENSMUSG00000015619
UniProt
P23771
P23772
RefSeq (мРНК)
NM_001002295
NM_002051
NM_008091
NM_001355110
NM_001355111
NM_001355112
RefSeq (білок)
NP_001002295
NP_002042
NP_032117
NP_001342039
NP_001342040
NP_001342041
Локус (UCSC) Хр. 10: 8.05 – 8.08 Mb Хр. 2: 9.86 – 9.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GATA3 (англ. GATA binding protein 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 443 амінокислот, а молекулярна маса — 47 916[5].

Послідовність амінокислот
1020304050
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVL
FNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGG
KALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHL
FTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
SRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCK
SRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL
IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNI
NRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHM
SSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література

  • Marine J., Winoto A. (1991). The human enhancer-binding protein Gata3 binds to several T-cell receptor regulatory elements. Proc. Natl. Acad. Sci. U.S.A. 88: 7284—7288. PMID 1871134 DOI:10.1073/pnas.88.16.7284
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504

Примітки

  1. Захворювання, генетично пов'язані з GATA3 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:4172 (англ.) . Процитовано 8 вересня 2017.
  5. UniProt, P23771 (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 8 вересня 2017.

Див. також

  • Хромосома 10
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

Фактори транскрипції та внутрішньоклітинні рецептори
(1) Основні домени
(1.1) Лейцинова застібка (bZIP)
(1.2) Спіраль-петля-спіраль (bHLH)
(1.3) Спіраль-петля-спіраль
/ Лейцинова застібка
(bHLH-ZIP)
(1.4) NF-1
(1.5) RF-X
(1.6) Спіраль-інтервал-спіраль (bHSH)
(2) Цинк-координовані домени ДНК
(2.1)Ядерні рецептори з цинковими пальцями (Cys4)
підродина 1
підродина 2
підродина 3
підродина 4
підродина 5
підродина 6
підродина 0
(2.2) Інші цинкові пальці Cys4
(2.3) Cys2His2 з доменом цинкових пальців
(2.4) Cys6 цистеїн-цинковий кластер
(2.5) Цинкові пальці іншого складу
(2.6) WRKY
  • WRKY
(3) Домени спіраль-поворот-спіраль
(3.1) Гомеобокс
(3.2) Парний бокс
(3.3) Вилкова головка / Крилата спіраль
(3.4) Фактори теплового шоку
(3.5) Триптофановий кластер
(3.6) Домен транскрипційний енхансер
(4) Бета-складчасті фактори з незначним жолобковим контактом
(4.1) RHR
(4.2) STAT
(4.3) p53
(4.4) MADS
(4.6) TATA
(4.7) Високомобільна група
(4.9) Grainyhead
(4.10) Домен холодового шоку
(4.11) Runt
(0) Інші фактори транскрипції
(0.2) HMGI(Y)
(0.3) Pocket домен
(0.5) AP2/EREBP-подібні
  • AP2
  • EREBP
  • B3
(0.6) Інші