IL1B

IL1B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1HIB, 1I1B, 1IOB, 1ITB, 1L2H, 1S0L, 1T4Q, 1TOO, 1TP0, 1TWE, 1TWM, 21BI, 2I1B, 2KH2, 2NVH, 31BI, 3O4O, 3POK, 41BI, 4DEP, 4G6J, 4G6M, 4GAI, 4I1B, 5I1B, 6I1B, 7I1B, 9ILB, 4GAF, 5BVP

Ідентифікатори
Символи IL1B, IL-1, IL1-BETA, IL1F2, interleukin 1 beta, IL1beta
Зовнішні ІД OMIM: 147720 MGI: 96543 HomoloGene: 481 GeneCards: IL1B
Онтологія гена
Молекулярна функція

protein domain specific binding
interleukin-1 receptor binding
cytokine activity
integrin binding
GO:0001948, GO:0016582 protein binding

Клітинна компонента

цитоплазма
гіалоплазма
extracellular region
лізосома
екзосома
secretory granule
везикула
міжклітинний простір

Біологічний процес

positive regulation of protein phosphorylation
smooth muscle adaptation
positive regulation of calcidiol 1-monooxygenase activity
GO:1903105 negative regulation of insulin receptor signaling pathway
cellular response to mechanical stimulus
positive regulation of interleukin-8 production
positive regulation of mitotic nuclear division
response to carbohydrate
embryo implantation
regulation of I-kappaB kinase/NF-kappaB signaling
negative regulation of cell population proliferation
GO:0097285 апоптоз
cellular response to organic substance
positive regulation of phagocytosis
regulation of insulin secretion
neutrophil chemotaxis
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
positive regulation of protein export from nucleus
positive regulation of prostaglandin secretion
positive regulation of myosin light chain kinase activity
negative regulation of MAP kinase activity
positive regulation of T cell proliferation
positive regulation of interleukin-6 production
inflammatory response
negative regulation of lipid metabolic process
sequestering of triglyceride
hyaluronan biosynthetic process
positive regulation of heterotypic cell-cell adhesion
positive regulation of lipid catabolic process
GO:1904579 cellular response to organic cyclic compound
positive regulation of fever generation
positive regulation of DNA-binding transcription factor activity
positive regulation of angiogenesis
response to lipopolysaccharide
positive regulation of NF-kappaB transcription factor activity
positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0046730, GO:0046737, GO:0046738, GO:0046736 імунна відповідь
ectopic germ cell programmed cell death
leukocyte migration
lipopolysaccharide-mediated signaling pathway
positive regulation of vascular endothelial growth factor receptor signaling pathway
positive regulation of cell adhesion molecule production
response to ATP
monocyte aggregation
protein kinase B signaling
positive regulation of nitric oxide biosynthetic process
cell-cell signaling
positive regulation of monocyte chemotactic protein-1 production
regulation of nitric-oxide synthase activity
positive regulation of membrane protein ectodomain proteolysis
positive regulation of interferon-gamma production
MAPK cascade
positive regulation of histone acetylation
GO:1901313 positive regulation of gene expression
negative regulation of glucose transmembrane transport
interleukin-1 beta production
positive regulation of T cell mediated immunity
extrinsic apoptotic signaling pathway in absence of ligand
positive regulation of I-kappaB kinase/NF-kappaB signaling
positive regulation of vascular endothelial growth factor production
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
negative regulation of lipid catabolic process
negative regulation of adiponectin secretion
regulation of establishment of endothelial barrier
positive regulation of cell division
GO:0072468 сигнальна трансдукція
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
cytokine-mediated signaling pathway
regulation of defense response to virus by host
fever generation
positive regulation of JNK cascade
positive regulation of cell population proliferation
regulation of signaling receptor activity
positive regulation of epithelial to mesenchymal transition
positive regulation of cell migration
interleukin-6 production
astrocyte activation
regulation of neurogenesis
negative regulation of neurogenesis
negative regulation of synaptic transmission
positive regulation of glial cell proliferation
regulation of ERK1 and ERK2 cascade
interleukin-1-mediated signaling pathway
cellular response to lipopolysaccharide
positive regulation of neuroinflammatory response
positive regulation of p38MAPK cascade
positive regulation of NIK/NF-kappaB signaling
positive regulation of T-helper 1 cell cytokine production
positive regulation of prostaglandin biosynthetic process
positive regulation of complement activation
positive regulation of inflammatory response
response to interleukin-1
positive regulation of RNA biosynthetic process

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
3553
16176
Ensembl
ENSG00000125538
ENSMUSG00000027398
UniProt
P01584
P10749
RefSeq (мРНК)
NM_000576
NM_008361
RefSeq (білок)
NP_000567
NP_032387
Локус (UCSC) Хр. 2: 112.83 – 112.84 Mb Хр. 2: 129.21 – 129.21 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IL1B (англ. Interleukin 1 beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 269 амінокислот, а молекулярна маса — 30 748[4].

Послідовність амінокислот
1020304050
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL
RISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEE
EPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQ
DMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLES
VDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFL
GGTKGGQDITDFTMQFVSS

Кодований геном білок за функціями належить до цитокінів, мітогенів. Задіяний у таких біологічних процесах як запальна відповідь, поліморфізм. Локалізований у цитоплазмі, лізосомі. Також секретований назовні.

Література

  • Clark B.D., Collins K.L., Gandy M.S., Webb A.C., Auron P.E. (1986). Genomic sequence for human prointerleukin 1 beta: possible evolution from a reverse transcribed prointerleukin 1 alpha gene. Nucleic Acids Res. 14: 7897—7914. PMID 3490654 DOI:10.1093/nar/14.20.7897
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Mizutani H., Schechter N., Lazarus G., Black R.A., Kupper T.S. (1991). Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase. J. Exp. Med. 174: 821—825. PMID 1919436 DOI:10.1084/jem.174.4.821
  • Nanduri V.B., Hulmes J.D., Pan Y.C., Kilian P.L., Stern A.S. (1991). The role of arginine residues in interleukin 1 receptor binding. Biochim. Biophys. Acta. 1118: 25—35. PMID 1837236 DOI:10.1016/0167-4838(91)90437-5
  • Piccioli P., Rubartelli A. (2013). The secretion of IL-1beta and options for release. Semin. Immunol. 25: 425—429. PMID 24201029 DOI:10.1016/j.smim.2013.10.007
  • Priestle J.P., Schar H.-P., Gruetter M.G. (1989). Crystallographic refinement of interleukin 1 beta at 2.0-A resolution. Proc. Natl. Acad. Sci. U.S.A. 86: 9667—9671. PMID 2602367 DOI:10.1073/pnas.86.24.9667

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:5992 (англ.) . Процитовано 28 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P01584 (англ.) . Архів оригіналу за 20 серпня 2017. Процитовано 28 серпня 2017.

Див. також

  • Хромосома 2

П:  Портал «Біологія» П:  Портал «Хімія»


Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.