SMAD3

SMAD3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

2LB2, 1MHD, 1MJS, 1MK2, 1OZJ, 1U7F, 2LAJ, 5OD6, 5ODG

Ідентифікатори
Символи SMAD3, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3, SMAD family member 3
Зовнішні ІД OMIM: 603109 MGI: 1201674 HomoloGene: 55937 GeneCards: SMAD3
Пов'язані генетичні захворювання
запальні захворювання кишківника, Хвороба Крона, бронхіальна астма, ішемічна хвороба серця, колоректальний рак, aneurysm-osteoarthritis syndrome[1]
Онтологія гена
Молекулярна функція

phosphatase binding
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
R-SMAD binding
co-SMAD binding
RNA polymerase II transcription regulatory region sequence-specific DNA binding
transcription factor binding
зв'язування з іоном металу
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
enzyme binding
transforming growth factor beta receptor binding
protein homodimerization activity
collagen binding
zinc ion binding
chromatin binding
GO:0001158 cis-regulatory region sequence-specific DNA binding
GO:0001948, GO:0016582 protein binding
double-stranded DNA binding
protein kinase binding
sequence-specific DNA binding
DNA binding
bHLH transcription factor binding
ubiquitin binding
identical protein binding
protein heterodimerization activity
chromatin DNA binding
ubiquitin protein ligase binding
beta-catenin binding
GO:0000983 RNA polymerase II general transcription initiation factor activity
DEAD/H-box RNA helicase binding
mineralocorticoid receptor binding
glucocorticoid receptor binding
primary miRNA binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
SMAD binding
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001104 transcription coregulator activity

Клітинна компонента

цитоплазма
клітинне ядро
heteromeric SMAD protein complex
SMAD protein complex
transcription regulator complex
receptor complex
клітинна мембрана
внутрішньоклітинний
нуклеоплазма
nuclear inner membrane
гіалоплазма
GO:0009327 protein-containing complex

Біологічний процес

somitogenesis
skeletal system development
ureteric bud development
endoderm development
regulation of transforming growth factor beta2 production
embryonic pattern specification
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
negative regulation of osteoblast differentiation
heart looping
positive regulation of chondrocyte differentiation
positive regulation of alkaline phosphatase activity
positive regulation of interleukin-1 beta production
pericardium development
regulation of binding
negative regulation of wound healing
activation of cysteine-type endopeptidase activity involved in apoptotic process
transforming growth factor beta receptor signaling pathway
negative regulation of inflammatory response
positive regulation of positive chemotaxis
negative regulation of cell population proliferation
negative regulation of fat cell differentiation
cell-cell junction organization
GO:0009373 regulation of transcription, DNA-templated
extrinsic apoptotic signaling pathway
activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
signal transduction involved in regulation of gene expression
in utero embryonic development
negative regulation of transforming growth factor beta receptor signaling pathway
nodal signaling pathway
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
negative regulation of cell growth
regulation of immune response
positive regulation of transforming growth factor beta3 production
T cell activation
activin receptor signaling pathway
regulation of striated muscle tissue development
embryonic foregut morphogenesis
positive regulation of bone mineralization
Загоєння ран
negative regulation of apoptotic process
positive regulation of extracellular matrix assembly
GO:1901227 negative regulation of transcription by RNA polymerase II
positive regulation of epithelial to mesenchymal transition
GO:0019049, GO:0030683 mitigation of host defenses by virus
thyroid gland development
developmental growth
lens fiber cell differentiation
гаструляція
GO:0046730, GO:0046737, GO:0046738, GO:0046736 імунна відповідь
osteoblast differentiation
GO:1990744, GO:1990729 primary miRNA processing
negative regulation of osteoblast proliferation
osteoblast development
embryonic cranial skeleton morphogenesis
transdifferentiation
paraxial mesoderm morphogenesis
response to hypoxia
positive regulation of cell migration
mesoderm formation
regulation of transforming growth factor beta receptor signaling pathway
GO:1901313 positive regulation of gene expression
immune system development
positive regulation of focal adhesion assembly
liver development
regulation of epithelial cell proliferation
positive regulation of stress fiber assembly
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
negative regulation of mitotic cell cycle
negative regulation of cytosolic calcium ion concentration
canonical Wnt signaling pathway
protein stabilization
transcription, DNA-templated
GO:1903363 negative regulation of protein catabolic process
protein deubiquitination
positive regulation of nitric oxide biosynthetic process
negative regulation of lung blood pressure
positive regulation of pri-miRNA transcription by RNA polymerase II
negative regulation of cardiac muscle hypertrophy in response to stress
cellular response to transforming growth factor beta stimulus
cellular response to cytokine stimulus
positive regulation of protein import into nucleus
positive regulation of DNA-binding transcription factor activity
SMAD protein signal transduction
positive regulation of canonical Wnt signaling pathway
SMAD protein complex assembly
adrenal gland development

Джерела:Amigo / QuickGO
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
4088
17127
Ensembl
ENSG00000166949
ENSMUSG00000032402
UniProt
P84022
Q8BUN5
RefSeq (мРНК)
NM_001145102
NM_001145103
NM_001145104
NM_005902
NM_016769
RefSeq (білок)
NP_001138574
NP_001138575
NP_001138576
NP_005893
NP_058049
Локус (UCSC) Хр. 15: 67.06 – 67.2 Mb Хр. 9: 63.55 – 63.67 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SMAD3 (англ. SMAD family member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 425 амінокислот, а молекулярна маса — 48 081[5].

Послідовність амінокислот
1020304050
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
LEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSH
HELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEF
PPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM
DAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA
SQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAA
LLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHL
NGPLQWLDKVLTQMGSPSIRCSSVS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література

  • Zhang Y., Feng X.-H., Wu R.-Y., Derynck R. (1996). Receptor-associated Mad homologues synergize as effectors of the TGF-beta response. Nature. 383: 168—172. PMID 8774881 DOI:10.1038/383168a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Tsukazaki T., Chiang T.A., Davison A.F., Attisano L., Wrana J.L. (1998). SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor. Cell. 95: 779—791. PMID 9865696 DOI:10.1016/S0092-8674(00)81701-8
  • Kawabata M., Inoue H., Hanyu A., Imamura T., Miyazono K. (1998). Smad proteins exist as monomers in vivo and undergo homo- and hetero-oligomerization upon activation by serine/threonine kinase receptors. EMBO J. 17: 4056—4065. PMID 9670020 DOI:10.1093/emboj/17.14.4056
  • Zhang Y., Feng X.H., Derynck R. (1998). Smad3 and Smad4 cooperate with c-Jun/c-Fos to mediate TGF-beta-induced transcription. Nature. 394: 909—913. PMID 9732876 DOI:10.1038/29814
  • Lebrun J.J., Takabe K., Chen Y., Vale W. (1999). Roles of pathway-specific and inhibitory Smads in activin receptor signaling. Mol. Endocrinol. 13: 15—23. PMID 9892009 DOI:10.1210/mend.13.1.0218

Примітки

  1. Захворювання, генетично пов'язані з SMAD3 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:6769 (англ.) . Процитовано 11 вересня 2017.
  5. UniProt, P84022 (англ.) . Архів оригіналу за 5 вересня 2017. Процитовано 11 вересня 2017.

Див. також

  • Хромосома 15
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

Фактори транскрипції та внутрішньоклітинні рецептори
(1) Основні домени
(1.1) Лейцинова застібка (bZIP)
(1.2) Спіраль-петля-спіраль (bHLH)
(1.3) Спіраль-петля-спіраль
/ Лейцинова застібка
(bHLH-ZIP)
(1.4) NF-1
(1.5) RF-X
(1.6) Спіраль-інтервал-спіраль (bHSH)
(2) Цинк-координовані домени ДНК
(2.1)Ядерні рецептори з цинковими пальцями (Cys4)
підродина 1
підродина 2
підродина 3
підродина 4
підродина 5
підродина 6
підродина 0
(2.2) Інші цинкові пальці Cys4
(2.3) Cys2His2 з доменом цинкових пальців
(2.4) Cys6 цистеїн-цинковий кластер
(2.5) Цинкові пальці іншого складу
(2.6) WRKY
  • WRKY
(3) Домени спіраль-поворот-спіраль
(3.1) Гомеобокс
(3.2) Парний бокс
(3.3) Вилкова головка / Крилата спіраль
(3.4) Фактори теплового шоку
(3.5) Триптофановий кластер
(3.6) Домен транскрипційний енхансер
(4) Бета-складчасті фактори з незначним жолобковим контактом
(4.1) RHR
(4.2) STAT
(4.3) p53
(4.4) MADS
(4.6) TATA
(4.7) Високомобільна група
(4.9) Grainyhead
(4.10) Домен холодового шоку
(4.11) Runt
(0) Інші фактори транскрипції
(0.2) HMGI(Y)
(0.3) Pocket домен
(0.5) AP2/EREBP-подібні
  • AP2
  • EREBP
  • B3
(0.6) Інші