TIMP2

TIMP2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1BR9, 1GXD, 2TMP, 4ILW

Ідентифікатори
Символи TIMP2, CSC-21K, DDC8, TIMP metallopeptidase inhibitor 2
Зовнішні ІД OMIM: 188825 MGI: 98753 HomoloGene: 2444 GeneCards: TIMP2
Пов'язані генетичні захворювання
періодонтит, ожиріння[1]
Онтологія гена
Молекулярна функція

peptidase inhibitor activity
GO:0048551 enzyme inhibitor activity
зв'язування з іоном металу
integrin binding
GO:0001948, GO:0016582 protein binding
protease binding
metalloendopeptidase inhibitor activity
zinc ion binding

Клітинна компонента

growth cone
extracellular region
cell surface
neuronal cell body
neuron projection
екзосома
GO:0005578 Позаклітинна матриця
міжклітинний простір
specific granule lumen
tertiary granule lumen
ficolin-1-rich granule lumen
collagen-containing extracellular matrix

Біологічний процес

negative regulation of proteolysis
response to cytokine
negative regulation of peptidase activity
positive regulation of adenylate cyclase activity
GO:0010260 старіння людини
extracellular matrix disassembly
negative regulation of Ras protein signal transduction
central nervous system development
positive regulation of neuron differentiation
response to hormone
negative regulation of membrane protein ectodomain proteolysis
positive regulation of MAPK cascade
negative regulation of cell population proliferation
negative regulation of mitotic cell cycle
regulation of Rap protein signal transduction
negative regulation of endopeptidase activity
neutrophil degranulation
negative regulation of metallopeptidase activity
response to organic substance

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
7077
21858
Ensembl
ENSG00000035862
ENSMUSG00000017466
UniProt
P16035
P25785
RefSeq (мРНК)
NM_003255
NM_011594
RefSeq (білок)
NP_003246
н/д
Локус (UCSC) Хр. 17: 78.85 – 78.93 Mb Хр. 11: 118.19 – 118.25 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TIMP2 (англ. TIMP metallopeptidase inhibitor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 220 амінокислот, а молекулярна маса — 24 399[5].

Послідовність амінокислот
1020304050
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAV
SEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGV
SLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQM
GCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS
CAWYRGAAPPKQEFLDIEDP

Кодований геном білок за функціями належить до інгібіторів протеаз, інгібіторів металоферментів. Білок має сайт для зв'язування з іонами металів, іоном цинку. Секретований назовні.

Література

  • Boone T.C., Johnson M.J., de Clerck Y.A., Langley K.E. (1990). cDNA cloning and expression of a metalloproteinase inhibitor related to tissue inhibitor of metalloproteinases. Proc. Natl. Acad. Sci. U.S.A. 87: 2800—2804. PMID 2157214 DOI:10.1073/pnas.87.7.2800
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Osthues A., Knaueper V., Oberhoff R., Reinke H., Tschesche H. (1992). Isolation and characterization of tissue inhibitors of metalloproteinases (TIMP-1 and TIMP-2) from human rheumatoid synovial fluid. FEBS Lett. 296: 16—20. PMID 1730286 DOI:10.1016/0014-5793(92)80393-U
  • de Clerck Y.A., Darville M.I., Eeckhout Y., Rousseau G.G. (1994). Characterization of the promoter of the gene encoding human tissue inhibitor of metalloproteinases-2 (TIMP-2). Gene. 139: 185—191. PMID 8112602 DOI:10.1016/0378-1119(94)90753-6
  • Chattopadhyay N., Mitra A., Frei E., Chatterjee A. (2001). Human cervical tumor cell (SiHa) surface alphavbeta3 integrin receptor has associated matrix metalloproteinase (MMP-2) activity. J. Cancer Res. Clin. Oncol. 127: 653—658. PMID 11710594 DOI:10.1007/s004320100271
  • Morgunova E., Tuuttila A., Bergmann U., Tryggvason K. (2002). Structural insight into the complex formation of latent matrix metalloproteinase 2 with tissue inhibitor of metalloproteinase 2. Proc. Natl. Acad. Sci. U.S.A. 99: 7414—7419. PMID 12032297 DOI:10.1073/pnas.102185399

Примітки

  1. Захворювання, генетично пов'язані з TIMP2 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:11821 (англ.) . Процитовано 12 вересня 2017.
  5. UniProt, P16035 (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 17
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.