WNT4

WNT4
Ідентифікатори
Символи WNT4, SERKAL, WNT-4, Wnt family member 4
Зовнішні ІД OMIM: 603490 MGI: 98957 HomoloGene: 22529 GeneCards: WNT4
Пов'язані генетичні захворювання
Синдром Маєра — Рокітанського — Кюстера — Гаузера[1]
Онтологія гена
Молекулярна функція

• GO:0001106 transcription corepressor activity
• signaling receptor binding
• GO:0005110 frizzled binding
• receptor ligand activity

Клітинна компонента

• цитоплазма
• endocytic vesicle membrane
• endoplasmic reticulum lumen
• extracellular region
• cell surface
• екзосома
• клітинна мембрана
• Golgi lumen
• міжклітинний простір
• GO:0005578 Позаклітинна матриця

Біологічний процес

• non-canonical Wnt signaling pathway
• T cell differentiation in thymus
• positive regulation of canonical Wnt signaling pathway
• negative regulation of male gonad development
• mesonephros development
• androgen biosynthetic process
• gamete generation
• negative regulation of wound healing
• metanephros development
• cellular response to transforming growth factor beta stimulus
• positive regulation of collagen biosynthetic process
• mesonephric tubule development
• cell fate commitment
• mammary gland epithelium development
• розвиток нирки
• negative regulation of cell differentiation
• metanephric nephron morphogenesis
• negative regulation of apoptotic signaling pathway
• female sex determination
• tube morphogenesis
• smooth muscle cell differentiation
• negative regulation of gene expression
• female gonad development
• GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
• GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
• branching involved in ureteric bud morphogenesis
• kidney morphogenesis
• nephron development
• paramesonephric duct development
• thyroid-stimulating hormone-secreting cell differentiation
• hormone metabolic process
• negative regulation of steroid biosynthetic process
• tertiary branching involved in mammary gland duct morphogenesis
• диференціація клітин
• male gonad development
• positive regulation of aldosterone biosynthetic process
• positive regulation of bone mineralization
• GO:1903374 anatomical structure development
• somatotropin secreting cell differentiation
• negative regulation of testicular blood vessel morphogenesis
• metanephric mesenchymal cell differentiation
• sex differentiation
• metanephric nephron development
• oocyte development
• negative regulation of cell migration
• positive regulation of osteoblast differentiation
• renal vesicle formation
• neuron differentiation
• regulation of cell-cell adhesion
• Епітеліально-мезенхімальний перехід
• canonical Wnt signaling pathway
• GO:0045996 negative regulation of transcription, DNA-templated
• branching morphogenesis of an epithelial tube
• metanephric tubule formation
• non-canonical Wnt signaling pathway via MAPK cascade
• negative regulation of testosterone biosynthetic process
• embryonic epithelial tube formation
• positive regulation of cortisol biosynthetic process
• positive regulation of dermatome development
• cellular response to starvation
• adrenal gland development
• multicellular organism development
• negative regulation of fibroblast growth factor receptor signaling pathway
• renal vesicle induction
• positive regulation of meiotic nuclear division
• positive regulation of focal adhesion assembly
• liver development
• immature T cell proliferation in thymus
• positive regulation of stress fiber assembly
• mesenchymal to epithelial transition
• Wnt signaling pathway
• negative regulation of canonical Wnt signaling pathway
• protein localization to plasma membrane
• regulation of signaling receptor activity
• negative regulation of androgen biosynthetic process

Джерела:Amigo / QuickGO
Ортологи
Види Людина Миша
Entrez
54361
22417
Ensembl
ENSG00000162552
ENSMUSG00000036856
UniProt
P56705
P22724
RefSeq (мРНК)
NM_030761
NM_009523
RefSeq (білок)
NP_110388
NP_033549
Локус (UCSC) Хр. 1: 22.12 – 22.14 Mb Хр. 4: 137 – 137.03 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

WNT4 (англ. Wnt family member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 351 амінокислот, а молекулярна маса — 39 052[5].

Послідовність амінокислот
1020304050
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLI
QRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGK
VVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGF
QWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILT
HMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVG
SSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTC
R

Кодований геном білок за функцією належить до білків розвитку. Задіяний у такому біологічному процесі як сигнальний шлях Wnt. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Biason-Lauber A., Konrad D., Navratil F., Schoenle E.J. (2004). A WNT4 mutation associated with Muellerian-duct regression and virilization in a 46,XX woman. N. Engl. J. Med. 351: 792—798. PMID 15317892 DOI:10.1056/NEJMoa040533
  • Huguet E.L., McMahon J.A., McMahon A.P., Bicknell R., Harris A.L. (1994). Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue. Cancer Res. 54: 2615—2621. PMID 8168088

Примітки

  1. ↑ Захворювання, генетично пов'язані з WNT4 переглянути/редагувати посилання на ВікіДаних.
  2. ↑ Human PubMed Reference:.
  3. ↑ Mouse PubMed Reference:.
  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:12783 (англ.) . Процитовано 25 серпня 2017.
  5. ↑ UniProt, P56705 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 25 серпня 2017.

Див. також

  • Хромосома 1
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»